Recombinant Tityus bahiensis Toxin Tb2-II

Recombinant Tityus bahiensis Toxin Tb2-II
Artikelnummer
CSB-BP350784TEQ-1
Verpackungseinheit
1 mg
Hersteller
Cusabio

Verfügbarkeit: wird geladen...
Preis wird geladen...
Research Areas: Others

Uniprot: P60276

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 10.8 kDa

Gene Names: N/A

Organism: Tityus bahiensis(Brazilian scorpion)

Source: Baculovirus

Expression Region: 1-62aa

Protein Length: Full Length

Target Protein Sequence: KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC

Endotoxin: Not test.

Relevance: Beta toxins bind voltage-independently at site-4 of sodium channels and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing . This toxin is active against both mammals and insects.

Reference: "Purification, amino-acid sequence and partial characterization of two toxins with anti-insect activity from the venom of the South American scorpion Tityus bahiensis (Buthidae)."Pimenta A.M.C., Martin-Eauclaire M.-F., Rochat H., Figueiredo S.G., Kalapothakis E., Afonso L.C.C., De Lima M.E.Toxicon 39:1009-1019(2001)
Mehr Informationen
Artikelnummer CSB-BP350784TEQ-1
Hersteller Cusabio
Hersteller Artikelnummer CSB-BP350784TEQ-1
Verpackungseinheit 1 mg
Mengeneinheit STK
Produktinformation (PDF) Download
MSDS (PDF) Download