Research Areas: Others
Uniprot: O02380
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 6xHis-tagged
Purity: Greater than 85% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 17.3 kDa
Gene Names: N/A
Organism: Tyrophagus putrescentiae (Mold mite) (Acarus putrescentiae)
Source: E.coli
Expression Region: 16-141aa
Protein Length: Full Length of Mature Protein
Target Protein Sequence: GQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKLLATGEHGVLACGAVNTDVKP
Endotoxin: Not test.
Reference: "Cloning and characterisation of a group II allergen from the dust mite Tyrophagus putrescentiae."Eriksson T.L.J., Johansson E., Whitley P., Schmidt M., Elsayed S., van Hage-Hamsten M.Eur. J. Biochem. 251:443-447(1998)
Deutsch
English
