Rfc1 Antibody - C-terminal region : HRP

Rfc1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP56521_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rfc1 is a transcriptional repressor that regulates transcription of the vasoactive intestinal peptide receptor gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Rfc1

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: SPTKRESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Replication factor C subunit 1

Protein Size: 656

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56521_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56521_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 89809
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×