RFC1 Antibody - middle region : FITC

RFC1 Antibody - middle region : FITC
Artikelnummer
AVIARP56522_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RFC1

Molecular Weight: 128kDa

Peptide Sequence: Synthetic peptide located within the following region: AQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLALHMSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Replication factor C subunit 1

Protein Size: 1147

Purification: Affinity Purified

Subunit: 1
Mehr Informationen
Artikelnummer AVIARP56522_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56522_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5981
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×