RFPL3 Antibody - middle region : FITC

RFPL3 Antibody - middle region : FITC
Artikelnummer
AVIARP57945_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RFPL3

Key Reference: Rauch,T., (2006) Cancer Res. 66 (16), 7939-7947

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: VYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICPLMNSGTTDAPVRPGEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ret finger protein-like 3

Protein Size: 317

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57945_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57945_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10738
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×