RGD1307041 Antibody - middle region : Biotin

RGD1307041 Antibody - middle region : Biotin
Artikelnummer
AVIARP57230_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: MLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein RGD1307041 Ensembl ENSRNOP00000049378

Protein Size: 399

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57230_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57230_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 361182
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×