RGD1307041 Antibody - middle region : HRP

RGD1307041 Antibody - middle region : HRP
Artikelnummer
AVIARP57230_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: MLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein RGD1307041 Ensembl ENSRNOP00000049378

Protein Size: 399

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57230_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57230_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 361182
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×