RGD1561459 Antibody - N-terminal region : Biotin

RGD1561459 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55390_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1561459

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: IASLSWGQMKVQGSTLTYKDCKVWPGGSRAWDWRETGTEHSPGVQPADVK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein RGD1561459 Ensembl ENSRNOP00000016783

Protein Size: 124

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55390_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55390_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 361606
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×