RGD1561459 Antibody - N-terminal region : HRP

RGD1561459 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55390_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1561459

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: IASLSWGQMKVQGSTLTYKDCKVWPGGSRAWDWRETGTEHSPGVQPADVK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein RGD1561459 Ensembl ENSRNOP00000016783

Protein Size: 124

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55390_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55390_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 361606
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×