RGS22 Antibody - N-terminal region : FITC

RGS22 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55320_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RGS22 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RGS22

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 147kDa

Peptide Sequence: Synthetic peptide located within the following region: QTVSTFSLPCCVPYNKLKSPAISSVSENFIFDDGVHPRTKKDPSKTNKLI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Regulator of G-protein signaling 22

Protein Size: 1264

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55320_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55320_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26166
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×