Uniprot: O75916
Gene Name: RGS9
Immunogen: Recombinant human RGS9
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 99%
Core Sequence: PTKMRVERWAFNFSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGARRWINIDGKTMDITVKGLKHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKDMLAKA
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 98%, Pig - 99%, Cynomolgus monkey - 99%
Alternative gene names: /
Alternative protein names: Regulator of G-protein signaling 9; RGS9
Protein name: Regulator of G protein signaling 9
Clone No.: K24059_5E10
Antigen Species: Human
Target Name: RGS9
IHC Verification: -
IHC Dilution: N/A
WB Verification: succeed
WB Dilution: 1:1000
IP Verification: -
IP Dilution: N/A
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: -
Sandwich ELISA Dilution: N/A
Antigen ID: PP-6470
Cross reactivity: Not tested
Deutsch
English
