RHEB Antibody - middle region : Biotin

RHEB Antibody - middle region : Biotin
Artikelnummer
AVIARP56651_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene is a member of the small GTPase superfamily and encodes a lipid-anchored, cell membrane protein with five repeats of the RAS-related GTP-binding region. This protein is vital in regulation of growth and cell cycle progression due to its role in

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RHEB

Key Reference: Eom,M., (2008) Pathol. Int. 58 (4), 226-232

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTP-binding protein Rheb

Protein Size: 184

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56651_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56651_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 6009
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×