Rimklb Antibody - N-terminal region : Biotin

Rimklb Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57439_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Rimklb catalyzes the synthesis of beta-citryl-glutamate and N-acetyl-aspartyl-glutamate. Beta-citryl-glutamate is synthesized more efficiently than N-acetyl-aspartyl-glutamate.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rimklb

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: FRAVVMDEMVLTVEQGNLGLRISGELISAYPQVVVVRVPTPWVQSDSDIT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Beta-citryl-glutamate synthase B

Protein Size: 387

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57439_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57439_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 108653
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×