Rimklb Antibody - N-terminal region : HRP

Rimklb Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57439_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rimklb catalyzes the synthesis of beta-citryl-glutamate and N-acetyl-aspartyl-glutamate. Beta-citryl-glutamate is synthesized more efficiently than N-acetyl-aspartyl-glutamate.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rimklb

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: FRAVVMDEMVLTVEQGNLGLRISGELISAYPQVVVVRVPTPWVQSDSDIT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Beta-citryl-glutamate synthase B

Protein Size: 387

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57439_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57439_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 108653
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×