Rit1 Antibody - N-terminal region : Biotin

Rit1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56523_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Rit1

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: TMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFTAMRD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTP-binding protein Rit2

Protein Size: 192

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56523_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56523_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 499652
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×