RNF5 Antibody - C-terminal region : FITC

RNF5 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP58180_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNF5

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: FPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 180

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP58180_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58180_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6048
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×