RP11-269F19.9 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: RP11-269F19.9 (also known as TCTEX1D4) belongs to the dynein light chain Tctex-type family. The exact function of RP11-269F19.9 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-269F19.9

Key Reference: Meng,Q., (2006) J. Biol. Chem. 281 (48), 37069-37080

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: RGSMLGLAASFSRRNSLVGPGAGPGGQRPSLGPVPPLGSRVSFSGLPLAP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tctex1 domain-containing protein 4

Protein Size: 221

Purification: Affinity Purified

• Artikelnummer: AVIARP54425_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54425_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 343521
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin