RP11-529I10.4 Antibody - N-terminal region : FITC

RP11-529I10.4 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55256_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RP11-529I10.4 (DPCD) belongs to the DPCD family. It may play a role in the formation or function of ciliated cells. Deletion of the DPCD gene may be a cause of primary ciliary dyskinesia (PCD).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-529I10.4

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein DPCD

Protein Size: 203

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55256_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55256_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25911
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×