RP11-529I10.4 Antibody - N-terminal region : HRP

RP11-529I10.4 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55256_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RP11-529I10.4 (DPCD) belongs to the DPCD family. It may play a role in the formation or function of ciliated cells. Deletion of the DPCD gene may be a cause of primary ciliary dyskinesia (PCD).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-529I10.4

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein DPCD

Protein Size: 203

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55256_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55256_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25911
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×