RP2 Antibody - middle region : FITC

RP2 Antibody - middle region : FITC
Artikelnummer
AVIARP56724_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefo

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RP2

Key Reference: Grimwood,J., (2004) Nature 428 (6982), 529-535

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein XRP2

Protein Size: 350

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56724_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56724_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 6102
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×