RPA1 Antibody - middle region : HRP

RPA1 Antibody - middle region : HRP
Artikelnummer
AVIARP56526_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RPA1 plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair. RPA1 binds and subsequently stabilizes single-stranded DNA intermediates and thus prevents complementary DNA from reannealing

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPA1

Key Reference: Tomida,J., (2008) J. Biol. Chem. 283 (14), 9071-9079

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Replication protein A 70 kDa DNA-binding subunit

Protein Size: 616

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56526_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56526_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6117
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×