RPIA Antibody - N-terminal region : Biotin

RPIA Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55438_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency. The exact function of RPIA remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPIA

Key Reference: Huck,J.H., (2004) Am. J. Hum. Genet. 74 (4), 745-751

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ribose-5-phosphate isomerase

Protein Size: 311

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55438_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55438_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22934
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×