RPIA Antibody - N-terminal region : HRP

RPIA Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55438_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency. The exact function of RPIA remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPIA

Key Reference: Huck,J.H., (2004) Am. J. Hum. Genet. 74 (4), 745-751

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ribose-5-phosphate isomerase

Protein Size: 311

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55438_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55438_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22934
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×