Rpl17 Antibody - C-terminal region : HRP

Rpl17 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP56130_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rpl17 is a component of the 60S subunit of the ribosome, the organelles that catalyze protein synthesis; member of the L22P family of ribosomal proteins; induced under amino acid deprivation of cells.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Rpl17

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: APKMRRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKIS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 60S ribosomal protein L17

Protein Size: 184

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56130_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56130_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 291434
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×