RPL18 Antibody - C-terminal region : Biotin

RPL18 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP56128_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18E family of ribosomal proteins that is a component of the 60S subunit. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPL18

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: QLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 188

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56128_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56128_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6141
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×