RPL30 Antibody - middle region : Biotin

RPL30 Antibody - middle region : Biotin
Artikelnummer
AVIARP56134_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL30 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene encoding RPL30 is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPL30

Key Reference: Beausoleil,S.A., (2006) Nat. Biotechnol. 24 (10), 1285-1292

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: MLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 60S ribosomal protein L30

Protein Size: 115

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56134_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56134_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6156
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×