Rpl5 Antibody - C-terminal region : HRP

Rpl5 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP56126_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rpl5 is required for rRNA maturation and formation of the 60S ribosomal subunits. This protein binds 5S RNA.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: RTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 60S ribosomal protein L5

Protein Size: 297

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56126_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56126_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 19983
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×