Rprd1b Antibody - C-terminal region : Biotin

Rprd1b Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP57533_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Rprd1b interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. It is a transcriptional regulator which enhances expression of CCND1. It promotes binding of RNA polymerase II to the CCDN1 promoter and to the termination region before the poly-A site but decreases its binding after the poly-A site. It prevents RNA polymerase II from reading through the 3' end termination site and may allow it to be recruited back to the promoter through promotion of the formation of a chromatin loop. It also enhances the transcription of a number of other cell cycle-related genes including CDK2, CDK4, CDK6 and cyclin-E but not CDKN1A, CDKN1B or cyclin-A. Rprd1b promotes cell proliferation.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rprd1b

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: QERSVYGGEFIQQLKLSMEDSKSPPPKAAEEKKSLKRTFQQIQEEEDDDY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Regulation of nuclear pre-mRNA domain-containing protein 1B

Protein Size: 224

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57533_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57533_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 70470
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×