RPS6KA2 Antibody - middle region : FITC

RPS6KA2 Antibody - middle region : FITC
Artikelnummer
AVIARP56170_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RPS6KA2 is a serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB.This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPS6KA2

Key Reference: Wissing,J., (2007) Mol. Cell Proteomics 6 (3), 537-547

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ribosomal protein S6 kinase alpha-2

Protein Size: 733

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56170_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56170_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6196
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×