RPS6KB1 Antibody - N-terminal region : Biotin

RPS6KB1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56554_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this prot

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPS6KB1

Key Reference: Ma,X.M., (2008) Cell 133 (2), 303-313

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: KFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ribosomal protein S6 kinase beta-1

Protein Size: 525

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56554_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56554_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6198
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×