RRAGC Antibody - N-terminal region : FITC

RRAGC Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57618_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RRAGC is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RRAGC

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related GTP-binding protein C

Protein Size: 399

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57618_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57618_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64121
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×