RRAGC Antibody - N-terminal region : HRP

RRAGC Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57618_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RRAGC is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RRAGC

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related GTP-binding protein C

Protein Size: 399

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57618_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57618_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64121
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×