Rras Antibody - C-terminal region : HRP

Rras Antibody - C-terminal region : HRP
Artikelnummer
AVIARP56712_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rras regulates the organization of the actin cytoskeleton

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Rras

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: ASSFSASHHMTYFEASAKLRLNVDEAFEQLVRTVRKYQEQELPPSPPSAP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein R-Ras

Protein Size: 218

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56712_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56712_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 361568
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×