RSAD1 Antibody - middle region : HRP

RSAD1 Antibody - middle region : HRP
Artikelnummer
AVIARP57212_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RSAD1 may be involved in porphyrin cofactor biosynthesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RSAD1

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: NWTYWQCGQYLGVGPGAHGRFMPQGAGGHTREARIQTLEPDNWMKEVMLF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Radical S-adenosyl methionine domain-containing protein 1, mitochondrial

Protein Size: 442

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57212_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57212_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55316
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×