RSBN1 Antibody - N-terminal region : FITC

RSBN1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57221_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RSBN1

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: GGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Round spermatid basic protein 1

Protein Size: 802

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57221_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57221_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54665
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×