RSPH10B Antibody - N-terminal region : FITC

RSPH10B Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56026_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human R10B2

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: THTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: radial spoke head 10 homolog B; radial spoke head 10 homolog B2

Protein Size: 280

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56026_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56026_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 222967
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×