RSPH14 Antibody - middle region : HRP

RSPH14 Antibody - middle region : HRP
Artikelnummer
AVIARP55056_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RTDR1

Key Reference: Gerhard,D.S., (2005) Science 307 (5715), 1621-1625

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: radial spoke head 14 homolog

Protein Size: 348

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55056_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55056_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27156
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×