RTKN Antibody - N-terminal region : HRP

RTKN Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56210_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RTKN mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. RTKN may play a novel role in the organization of septin structures.This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RTKN

Key Reference: Sudo,K., (2007) Hum. Mutat. 28 (10), 1005-1013

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rhotekin

Protein Size: 563

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56210_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56210_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6242
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×