RWDD1 Antibody - middle region : HRP

RWDD1 Antibody - middle region : HRP
Artikelnummer
AVIARP56838_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RWDD1

Key Reference: Stelzl,U., (2005) Cell 122 (6), 957-968

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: RWD domain-containing protein 1

Protein Size: 147

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56838_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56838_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51389
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×