S100a5 Antibody - middle region : HRP

S100a5 Antibody - middle region : HRP
Artikelnummer
AVIARP56530_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: SLAEKMKESSIDNLMKSLDKNSDQEIDFKEYSVFLTTLCMAYNDFFLEDN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: S100 calcium binding protein A5 EMBL AAI17109.1

Protein Size: 93

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56530_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56530_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 20199
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×