S100A5 Antibody - N-terminal region : HRP

S100A5 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56529_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has a Ca2+ affinity 20- to 100-fold higher than the other S100 proteins studied under identical conditions. This protein also binds Zn2+ and Cu2+, and Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the adult brain.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human S10A5

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: ETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: protein S100-A5

Protein Size: 92

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56529_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56529_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6276
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×