S100A9 Antibody - middle region : FITC

S100A9 Antibody - middle region : FITC
Artikelnummer
AVIARP56534_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human S100A9

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: DLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein S100-A9

Protein Size: 114

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56534_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56534_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6280
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×