S100A9 Antibody - N-terminal region : Biotin

S100A9 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56533_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human S100A9

Key Reference: Ghavami,S., (2008) Biochim. Biophys. Acta 1783 (2), 297-311

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein S100-A9

Protein Size: 114

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56533_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56533_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 6280
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×