SAMD4A Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein.Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein (Baez and Boccaccio, 2005 [PubMed 16221671]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SAMD4A

Key Reference: Baez,M.V. (2005) J. Biol. Chem. 280 (52), 43131-43140

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Smaug homolog 1

Protein Size: 717

Purification: Affinity Purified

• Artikelnummer: AVIARP53707_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53707_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23034
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin