SAMD4A Antibody - middle region : HRP

SAMD4A Antibody - middle region : HRP
Artikelnummer
AVIARP53707_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein.Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein (Baez and Boccaccio, 2005 [PubMed 16221671]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SAMD4A

Key Reference: Baez,M.V. (2005) J. Biol. Chem. 280 (52), 43131-43140

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein Smaug homolog 1

Protein Size: 717

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53707_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53707_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23034
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×