SAMHD1 Antibody - middle region : Biotin

SAMHD1 Antibody - middle region : Biotin
Artikelnummer
AVIARP55262_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: SAMHD1 contains 1 HD domain and 1 SAM (sterile alpha motif) domain. SAMHD1 may play a role in mediating proinflammatory responses to TNF-alpha signaling.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SAMHD1

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: KGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SAM domain and HD domain-containing protein 1

Protein Size: 626

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55262_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55262_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25939
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×