SAP130 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SAP130 is a subunit of the histone deacetylase-dependent SIN3A corepressor complex.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SAP130

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: ANNLSMPTSDLPPGASPRKKPRKQQHVISTEEGDMMETNSTDDEKSTAKS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Histone deacetylase complex subunit SAP130

Protein Size: 613

Purification: Affinity Purified

• Artikelnummer: AVIARP53768_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53768_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 79595
• Wirt: Rabbit
• Konjugat: Conjugated, HRP