SAR1A Antibody - middle region : FITC

SAR1A Antibody - middle region : FITC
Artikelnummer
AVIARP56244_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse SAR1A

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: AISEERLREMFGLYGQTTGKGSVSLKELNARPLGVFMCSVLKRQGYGEGF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTP-binding protein SAR1a

Protein Size: 198

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56244_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56244_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56681
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×