SAR1B Antibody - middle region : Biotin

SAR1B Antibody - middle region : Biotin
Artikelnummer
AVIARP56243_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: SAR1B is involved in transport from the endoplasmic reticulum to the Golgi apparatus. SAR1B is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SAR1B

Key Reference: Charcosset,M., (2008) Mol. Genet. Metab. 93 (1), 74-84

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTP-binding protein SAR1b

Protein Size: 198

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56243_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56243_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51128
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×