SAR1B Antibody - middle region : HRP

SAR1B Antibody - middle region : HRP
Artikelnummer
AVIARP56243_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SAR1B is involved in transport from the endoplasmic reticulum to the Golgi apparatus. SAR1B is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SAR1B

Key Reference: Charcosset,M., (2008) Mol. Genet. Metab. 93 (1), 74-84

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: GTP-binding protein SAR1b

Protein Size: 198

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56243_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56243_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51128
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×